PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P27440_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 684aa    MW: 73620.1 Da    PI: 8.297
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P27440_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-095215581954
                            HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  GSMUA_Achr7P27440_001 521 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 558
                            554458******************************88 PP

2BELL95.25.8e-313994521972
                   BELL  19 VdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                            Vd+rY++y++q+q+v++sF+ v+g g+a+pYtslA+ka+SrhFrcLkdaia q+
  GSMUA_Achr7P27440_001 399 VDRRYNHYCDQMQMVVNSFDSVMGFGAATPYTSLAQKAMSRHFRCLKDAIAAQL 452
                            9**************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.2E-66285450IPR006563POX domain
PfamPF075261.2E-50290449IPR006563POX domain
PROSITE profilePS5007112.293499562IPR001356Homeobox domain
SMARTSM003895.3E-9502566IPR001356Homeobox domain
CDDcd000865.11E-13502563No hitNo description
SuperFamilySSF466895.56E-17503568IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-27505568IPR009057Homeodomain-like
PfamPF059203.4E-18519558IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 684 aa     Download sequence    Send to blast
MGIATQPSQL TFAYLSPPSK TLGGTQAGPS SPASMSQGFH QGIFSFPEGF DRSANREQQQ  60
NHHVAQQSRR DKLRVQGFDA AGHPLVPIDE HGEEASIYGS TAVGAGNMLS DMFSFPAAGL  120
TAVDLHANQI SGGFHLPPRP AATAGGFTGD WYGPTRQGNQ QQHSVTALNA DSAAAMQLFL  180
MNPLLQPPPP QQQRPNSPSP PPPAHQQAFQ SFGDAPFGGR VAEGQGLSLS LSSSLQQLEM  240
AKADELRFRE GVLYFNNQQQ QHSTLHLQGQ VPGHGQQSHM GYGSMGLVNV LRNSKYAKPG  300
QELLEEFCSV GKGQLKGSKA GRHRGGSSNP NCNPTGGGGS GGASSSAAAS SSSKDVPPLA  360
PADRFEHQRK KAKLISMLDE ACIKNACGLS GTSICHSCVD RRYNHYCDQM QMVVNSFDSV  420
MGFGAATPYT SLAQKAMSRH FRCLKDAIAA QLKQTCELLG EKESATGSGI TKGDTPRLRL  480
LDQTLRQQRA FNQMGMMEQE AWRPQRGLPD RSVHILRGWL FEHFLHPYPS DADKHLLARQ  540
TGLSRNQVSN WFINARVRLW KPMVEDMYLQ ESKEEEQGQR TETNAPSESD ASPSTSSVSR  600
RHHRLAAASE NPPPGLVAAH QPSGGDDDSV LVGVNAFAAL NAAHVGDMYR HGTAGDVSLT  660
LGLRHAGGST SEKNRFSLRN FGGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B1e-15508565158Homeobox protein Meis1
4xrs_A1e-15508565158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009411323.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-139BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLM0TL800.0M0TL80_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P27440_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-127BEL1-like homeodomain 4